top of page

CircRNA

Gene

chr20|35494523|35505005|+|7|circRNA|CEP250|ENST00000397527.5|24,25,26,27,28,29,30

CEP250

Open Reading Frame (ORF)

LSLGNRRKLCWPSSSSVLSRHRSMRWRPGPCRTAGCRPRQCSRNGTRSWKLCGQKVSPPGIRRRLPGPGLRLCRRPLARLMLPCRGKSSISSSRQN

Peptide

SSISSSRQN

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page