top of page

CircRNA

Gene

chr20|20583049|20601846|-|5|circRNA|RALGAPA2|ENST00000430436.5|14,13,12,11,10

RALGAPA2

Open Reading Frame (ORF)

LVTTESHRCFKFNRLCSRSSERNHRGEVLFSQLAEPPRCDRTDAI

Peptide

GEVLFSQLAEPPR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page