top of page

CircRNA

Gene

chr20|18628126|18744271|+|2|circRNA|DTD1|ENST00000377452.3|4,5

DTD1

Open Reading Frame (ORF)

LNQARKETLPEKKTAVPAAGLRATCPLNGSRSSGGRIQMASLGPTCRCTFRMMGL

Peptide

TAVPAAGLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page