top of page

CircRNA

Gene

chr2|85630720|85639391|+|4|circRNA|USP39|NR_046347|6,7,8,9

USP39

Open Reading Frame (ORF)

LPPSTRTRRSSSSFPKCHSSTSWLSSMASLRRLYLMFLLSGTTFWKKTIIRTSNVLQGISCSCWSSVLES

Peptide

CHSSTSWLSSMASLR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page