top of page

CircRNA

Gene

chr2|74210049|74211175|+|1|ciRNA|MTHFD2|ENST00000394053.6|5

MTHFD2

Open Reading Frame (ORF)

LLSGNTVLFSPCKNFQKPSCACLEVLTLLYFVFVEILLTDNSGSNLCREAAPSVT

Peptide

EAAPSVT

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page