top of page

CircRNA

Gene

chr2|73447959|73455295|+|2|circRNA|ALMS1|ENST00000484298.5|7,8

ALMS1

Open Reading Frame (ORF)

LFLDQVIRRLGYPQHHLVSTHTERSPLFFPSRPCQTFFSLKKL

Peptide

LFLDQVIR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page