top of page

CircRNA

Gene

chr2|54621399|54623596|+|3|circRNA|SPTBN1|ENST00000356805.8|8,9,10

SPTBN1

CircRNA UID

circSPTBN1(8,9,10)

Open Reading Frame (ORF)

LEVLLFTIQSKMRANNQKVYMPREGKLISDINKTSAWTILMRSP

Peptide

LISDINKTSAWTILMR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page