top of page

CircRNA

Gene

chr2|47005921|47051880|+|10|circRNA|TTC7A|NM_001288953|10,11,12,13,14,15,16,17,18,19

TTC7A

CircRNA UID

circTTC7A(10,11,12,13,14,15,16,17,18,19)

Open Reading Frame (ORF)

LEEAMSELTMPSSVLKQGPMQLWTTLEQIWLQAGNSRCGAEPGAGAGGGPDSELAECRSHL

Peptide

QGPMQLWTTLEQIWLQAGNSRCGAEPGAGAGGGPDSELAECR

ORF Found in Long-Read

false

Peptide Length

42

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

24

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page