top of page

CircRNA

Gene

chr2|43973606|43975217|-|5|circRNA|LRPPRC|NM_133259|11,10,9,8,7

LRPPRC

Open Reading Frame (ORF)

LAKALMKAVKEEGFPIRPHYFWPLLVGRRKEKNVQVIWRMQKTFSQ

Peptide

NVQVIWR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page