top of page

CircRNA

Gene

chr2|39278406|39299801|-|9|circRNA|MAP4K3|ENST00000263881.7|24,23,22,21,20,19,18,17,16

MAP4K3

Open Reading Frame (ORF)

LVPKKGFIPSILMNFMKHQWNRICNWNMDKDTKVVTF

Peptide

HQWNRICNWNMDK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page