top of page

CircRNA

Gene

chr2|33257283|33280158|+|8|circRNA|LTBP1|ENST00000404816.6|12,13,14,15,16,17,18,19

LTBP1

Open Reading Frame (ORF)

LDLTSAFPAQKDSEAGMDSALLLLRKSVLVEWVIRFLAFIDAGQSITM

Peptide

DSEAGMDSALLLLR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page