top of page

CircRNA

Gene

chr2|27602462|27608039|+|3|circRNA|ZNF512|ENST00000413371.6|9,10,11

ZNF512

Open Reading Frame (ORF)

LYTTYRSWPLLNWPRNGPRGRCFRTWYLMIESPF

Peptide

LYTTYRSWPLLNWPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page