top of page

CircRNA

Gene

chr2|26279993|26285571|+|6|circRNA|HADHB|ENST00000537713.5|9,10,11,12,13,14

HADHB

Open Reading Frame (ORF)

LPPLEKFNNWGGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQEKIQLPKIMASVLPHWSRWPN

Peptide

EGGQYGLVAACAAGGQEKIQLPK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page