top of page

CircRNA

Gene

chr2|241654545|241668685|+|6|circRNA|ATG4B|ENST00000405546.7|5,6,7,8,9,10

ATG4B

Open Reading Frame (ORF)

LDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVIGGGHKGRGSQTATSASSTHSSTGRTVTTPFTR

Peptide

GRGSQTATSASSTHSSTGR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page