top of page

CircRNA

Gene

chr2|241403827|241434321|+|8|circRNA|FARP2|ENST00000264042.7|3,4,5,6,7,8,9,10

FARP2

Open Reading Frame (ORF)

MNVRTSGRFVWSITPFLDFWTNLSQKQKPSSSAGAPPSDTA

Peptide

QKPSSSAGAPPSDTA

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page