top of page

CircRNA

Gene

chr2|239990073|240021412|-|7|circRNA|NDUFA10|ENST00000252711.6|9,8,7,6,5,4,3

NDUFA10

Open Reading Frame (ORF)

LNYTSIPIFLPEVTIGAHQTDRVLHQFREASSTFLKRGFIIQTVPQEMGSPSPPTIMATVVWRNFTMIREAMMATVTACSPGCTAVACCSTQMPWSTC

Peptide

EASSTFLKR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page