top of page

CircRNA

Gene

chr2|230255451|230287966|+|7|circRNA|SP140|NM_001278452|10,11,12,13,14,15,16

SP140

Open Reading Frame (ORF)

LEPASLRVTELHRKESDQERAVMTVRKCVMEKSARKPLAP

Peptide

LEPASLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page