top of page

CircRNA

Gene

chr2|218640663|218645064|-|2|circRNA|ZNF142|ENST00000449707.5|9,8

ZNF142

Open Reading Frame (ORF)

MGTLLPRRMGVQSPALVMGIQFWFKSRRGLASPALHVPLAASRNGL

Peptide

GLASPALHVPLAASR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page