top of page

CircRNA

Gene

chr2|218474629|218482234|-|4|circRNA|USP37|ENST00000258399.7|20,19,18,17

USP37

Open Reading Frame (ORF)

MKMMISQLAAQIPDLQKMIFKKCQKIQTLWKLRSPKQSQSWGPHSPFETI

Peptide

IQTLWKLR

ORF Found in Long-Read

true

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page