top of page

CircRNA

Gene

chr2|203138161|203138748|+|2|circRNA|NBEAL1|NM_001114132|29,30

NBEAL1

Open Reading Frame (ORF)

MMLLFDCLSVCYSESPVWVKLSQIQIQLLLGFIGRGNLQFATKDVRMGNLRKQRSKN

Peptide

DVRMGNLR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page