top of page

CircRNA

Gene

chr2|199308759|199349173|-|4|circRNA|SATB2|ENST00000417098.5|10,9,8,7

SATB2

Open Reading Frame (ORF)

MRGMSSMRRSQGITTANACNTWSSFPLSRCSGKSGTRKPFRLLCSGPASNAFTKYEPAGIPGENQRTVSSQPNSPQYSNPKPSARITAHHEPWSSFSPA

Peptide

ITAHHEPWSSFSPA

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page