top of page

CircRNA

Gene

chr2|190435976|190437561|+|1|circRNA|MFSD6|ENST00000392328.5|3

MFSD6

Open Reading Frame (ORF)

LGLNQAALQRAVWLSAVCGLVHGFWIWLRVHLSLLAFGRPQWNYNPLWGLFSPESCV

Peptide

LGLNQAALQR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page