top of page

CircRNA

Gene

chr2|189852654|189855128|+|3|circRNA|PMS1|ENST00000418224.7|6,7,8

PMS1

Open Reading Frame (ORF)

MDHYLVQILMKIIKQMFPQLTSFLVKQQKQMCFLIKWNHLERIIQMLILQSFHSKMICIMMNLEKTLMIV

Peptide

QMFPQLTSFLVK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page