top of page

CircRNA

Gene

chr2|179444875|179446770|-|3|circRNA|ZNF385B|ENST00000466398.5|11,10,9

ZNF385B

CircRNA UID

circZNF385B(11,10,9)

Open Reading Frame (ORF)

LKVAHFSSNLAQHPCHLEQPLLPPRAQMELPVLLLNQKKKKPKNYFIVHYAKWL

Peptide

LKVAHFSSNLAQHPCHLEQPLLPPR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page