top of page

CircRNA

Gene

chr2|171448680|171458477|+|5|circRNA|DCAF17|ENST00000539783.5|4,5,6,7,8

DCAF17

Open Reading Frame (ORF)

MQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITGRYTSQFIRL

Peptide

WGGTTGTVGEAPFGIPCNIKITGR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page