top of page

CircRNA

Gene

chr2|159858361|159899059|-|15|circRNA|LY75-CD302|NM_001198759|16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

LY75-CD302

Open Reading Frame (ORF)

LLVIQNLNGCAKFQKLMTPSPSSMEIRASASSQCMAG

Peptide

FQKLMTPSPSSMEIR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page