top of page

CircRNA

Gene

chr2|159400598|159453801|-|13|circRNA|BAZ2B|ENST00000392782.5|16,15,14,13,12,11,10,9,8,7,6,5,4

BAZ2B

Open Reading Frame (ORF)

MEKELRAQQILEDIYSEQLGINRLTCPQCRVPSQWSATQSLVYIQPAQGIQNLVVWGHLVHPQP

Peptide

AQQILEDIYSEQLGINR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page