top of page

CircRNA

Gene

chr2|151428783|151435580|+|3|circRNA|RIF1|ENST00000444746.6|9,10,11

RIF1

CircRNA UID

circRIF1(9,10,11)

Open Reading Frame (ORF)

LIQSTISIDSNASPQGNSCHVATSPGLNPMTPVHKDLASKWEFHQFSLATRRTWIS

Peptide

DLASKWEFHQFSLATR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page