top of page

CircRNA

Gene

chr19|8463638|8466270|+|1|ciRNA|HNRNPM|ENST00000598367.5|2

HNRNPM

Open Reading Frame (ORF)

MVPDGIYKASASLLFLMKSVGHSLQQPFPARTLGWWPSRS

Peptide

ASASLLFLMKSVGHSLQQPFPAR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page