top of page

CircRNA

Gene

chr19|57863403|57868457|-|1|ciRNA|ZNF814|ENST00000595894.5|3

ZNF814

Open Reading Frame (ORF)

MVSGQFCNHNDILANKYNVWHLSLIYWIVKNCFKVLPNILRFISM

Peptide

VLPNILR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page