top of page

CircRNA

Gene

chr19|55852015|55862159|+|4|circRNA|NLRP4|ENST00000301295.10|2,3,4,5

NLRP4

Open Reading Frame (ORF)

LVSLLQKRWQPLSSLILVLCGIWRSSKRRSSGNLKNISSK

Peptide

RSSGNLK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page