top of page

CircRNA

Gene

chr19|4929221|4932956|+|3|circRNA|UHRF1|ENST00000612630.4|3,4,5

UHRF1

Open Reading Frame (ORF)

MNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGWRTAIPSSTTRSA

Peptide

ELYANVVLGWR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page