top of page

CircRNA

Gene

chr19|47264602|47266792|+|3|circRNA|CCDC9|ENST00000221922.10|6,7,8

CCDC9

Open Reading Frame (ORF)

MTLSMTGRERSEYLRWKQEREKIDQERLQRHRKPTGQWRREWDAEKTDGMSGRSGAGRTLRR

Peptide

TDGMSGRSGAGR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page