top of page

CircRNA

Gene

chr19|39979816|39980717|+|4|circRNA|PSMC4|ENST00000157812.6|7,8,9,10

PSMC4

Open Reading Frame (ORF)

LHSSGSWARSLYRSIWVRAPAWSGMCSAWPRRMHLPSSS

Peptide

APAWSGMCSAWPR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page