top of page

CircRNA

Gene

chr19|37819496|37820306|+|2|circRNA|CTD-2554C21.2|ENST00000590433.5|2,3

CTD-2554C21.2

Open Reading Frame (ORF)

LIYSCSSKTMAHCLCSVQKPQKKFWTMWAFNLLRWE

Peptide

FWTMWAFNLLRWE

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page