top of page

CircRNA

Gene

chr19|3743938|3748081|+|5|circRNA|TJP3|ENST00000541714.6|15,16,17,18,19

TJP3

Open Reading Frame (ORF)

LTSAATAALTATTRRTARAARTRMARATQTARGGPTRMWMMSPRLQPWPGPRSPCRQMSPRARGIVGESRLIRGPSQFQAPGSDPGTRGRHCYAEVDC

Peptide

MWMMSPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page