top of page

CircRNA

Gene

chr19|36718947|36720561|+|1|circRNA|ZNF567|ENST00000588311.5|4

ZNF567

Open Reading Frame (ORF)

MSVMTVGSPSARRQHSLYIRESIQVRNPTFVKNVGSPFTRRQILLYIRELIQGKSPIFVMNVGNPSPRRQPLLFMRKLIMRRNPIFVVNVESPSARRQPL

Peptide

MSVMTVGSPSAR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page