top of page

CircRNA

Gene

chr19|35722718|35722963|+|1|ciRNA|KMT2B|ENST00000420124.2|5

KMT2B

Open Reading Frame (ORF)

LVALWRRWGDWTAMSGLGMTPHLGDMHQEPRREGAKSGAQGLGGKWAGVLGPRATSFGGTRNLAL

Peptide

EGAKSGAQGLGGK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page