top of page

CircRNA

Gene

chr19|32347244|32354957|+|2|circRNA|ZNF507|NM_001136156|2,3

ZNF507

Open Reading Frame (ORF)

MWWNTSRMLNDPTVAACVTTQVATRATSSSTYESIDRDSLISVLSAST

Peptide

ATSSSTYESIDR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page