top of page

CircRNA

Gene

chr19|1969507|1969959|+|1|circRNA|CSNK1G2|ENST00000255641.12|2

CSNK1G2

Open Reading Frame (ORF)

LGATGPRPPTGRSDVLATEEPRPQVSRDLGFARQQSHRGEARVSQTYGF

Peptide

LGATGPRPPTGRSDVLATEEPRPQVSR

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page