top of page

CircRNA

Gene

chr19|11106564|11110771|+|3|circRNA|LDLR|ENST00000558518.5|5,6,7

LDLR

CircRNA UID

circLDLR(5,6,7)

Open Reading Frame (ORF)

MTLRSATSACAPTASSWWPSEDAKLWPPVALTNSSALMETASMAAGSVTGNMTART

Peptide

LWPPVALTNSSALMETASMAAGSVTGNMTART

ORF Found in Long-Read

false

Peptide Length

32

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page