top of page

CircRNA

Gene

chr19|10574416|10575029|-|2|circRNA|AP1M2|ENST00000587069.5|3,2

AP1M2

Open Reading Frame (ORF)

MKIIEKSGYQALPWVRYITQSGGGQGVLDASPLWPPQCGKGRGGGPAPHRGQV

Peptide

GGGPAPHR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page