top of page

CircRNA

Gene

chr18|9593875|9595017|-|1|ciRNA|PPP4R1|ENST00000400556.7|3

PPP4R1

Open Reading Frame (ORF)

LFFLCSMCIFFLLKWKWKGGFINFSRENESIHFKGGIINRHNLSHQVLFIITA

Peptide

GGFINFSRENESIHFK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page