top of page

CircRNA

Gene

chr18|74877196|74920692|+|4|circRNA|ZNF407|NM_017757|4,5,6,7

ZNF407

Open Reading Frame (ORF)

LKISANTFCILANMKESRCTTVPSVTTGPTSRWSSGTI

Peptide

ISANTFCILANMKESR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page