top of page

CircRNA

Gene

chr18|74630966|74641122|+|2|circRNA|ZNF407|ENST00000582337.5|2,3

ZNF407

Open Reading Frame (ORF)

MEKLTAIFLIKRSKYLQSQRTSPSRGMCTPREMLQAQVRISVCTVSLVLTPLLL

Peptide

EMLQAQVR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page