top of page

CircRNA

Gene

chr18|62359954|62361793|+|2|circRNA|TNFRSF11A|ENST00000616710.4|6,7

TNFRSF11A

Open Reading Frame (ORF)

LPGLIILLLFASVALVAAIIFGVCYRKKGKALTAVPSLERE

Peptide

ALTAVPSLERE

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page