top of page

CircRNA

Gene

chr18|2732264|2775924|+|18|circRNA|SMCHD1|ENST00000320876.10|25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42

SMCHD1

Open Reading Frame (ORF)

LTLHVVSMMKPKVVSRCCPLILFTRRLFQIGKEL

Peptide

CCPLILFTRR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page