top of page

CircRNA

Gene

chr18|23556242|23573574|-|7|circRNA|NPC1|ENST00000269228.9|8,7,6,5,4,3,2

NPC1

Open Reading Frame (ORF)

LAVSFSSRWSSLLRVRQAWCLSGSQPIQLTSGQPPAARLAWKKSTLTSTLGLSSGRSSSSSGPLSLTNTFTSHTLRELMYPLDLRLTYRYCTRCFHSPVFGMESVELHMGTRGTIANILAHQNHCQRMDMT

Peptide

LAVSFSSR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page