top of page

CircRNA

Gene

chr18|23234607|23253936|+|5|circRNA|CABLES1|ENST00000400473.6|5,6,7,8,9

CABLES1

CircRNA UID

circCABLES1(5,6,7,8,9)

Open Reading Frame (ORF)

LKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDGLEVGRRKTINWCSEFERDHWSGRCGAGC

Peptide

HLIDGLEVGRR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page