top of page

CircRNA

Gene

chr18|22936753|23001729|+|14|circRNA|RBBP8|ENST00000327155.9|2,3,4,5,6,7,8,9,10,11,12,13,14,15

RBBP8

Open Reading Frame (ORF)

MIAWKICLIGQHMKSMNPVWQTVSPKQQMKRRNCLLPQRNYTVFDLSKDDLIPL

Peptide

ICLIGQHMKSMNPVWQTVSPK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page